ChemicalBook Chinese

Company Information
Company Name:    Shanghai Hanhong Scientific Co.,Ltd.
Tel:    021-54302127,021-54306202,021-54308259,13764082696
Fax:    +86-21-54291107
Email:    jerry.ma@hanhonggroup.com
Nationality:    China
WebSite:    www.hanhonggroup.com
Product List:    28718
1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101

Product List
6-Mercaptopurine 6112-76-1
5-Iodouracil 696-07-1
Hypoxanthine 68-94-0
iso-Guaninesulfate 49722-90-9
5-Hydroxymethylcytosine 1123-95-1
5-Hydroxy methyluracil 4433-40-3
5-Hydroxyuracil 20636-41-3
Guanine hydrochloride 635-39-2
Guanine sulfate 10333-92-3
2-Hydroxy-6-aminopurine 3373-53-3
5-Fluorouracil 51-21-8
Guanine 73-40-5
7,9-Dimethylguanine 524-35-6
Dithiouracil 2001-93-6
5-Fluorocytosine 2022-85-7
N6,N6-dimethyladenosine 2620-62-4
Dihydrothymine 696-04-8
Dihydrouracil 504-07-4
2,6-Dichloropurine 5451-40-1
4,6-Diaminopyrimidine 2434-56-2
2,6-Diaminopurine 1904-98-9
Isocytosine 108-53-2
Cytosine 71-30-7
5-Chlorouracil 1820-81-1
6-Chloropurine 87-42-3
5-Bromouracil 51-20-7
8-Azaxanthine 1468-56-4
6-Azauracil 461-89-2
6-Azathymine 932-53-6
8-Azaguanine 134-58-7
8-Azaadenine 1123-54-2
5-Azacytosine 931-86-2
5-Aminouracil 932-52-5
2-Aminopyrimidine 109-12-6
2-Aminopurine 452-06-2
2-Amino-6-chloropurine 10310-21-1
Adenine sulfate 321-30-2
Adenine Phosphate 52175-10-7
Adenine hydrochloride 6055-72-7
Goserelin acetate 145781-92-6
6-Aminopurine 73-24-5
Y(d -A)DAIFTQSYRKVLAQLSARKLLQDILSR-NH2 863288-34-0
ACTH (1-24) (human, bovine, rat) 16960-16-0
Amyloid β-Protein (1-42) 107761-42-2
Glp-His-Trp-Ser-Tyr-D-Trp-Leu-Arg-Pro-NHEt 57773-65-6
(Nle4,D-Phe7)-α-MSH 75921-69-6
Ac-Tyr-Thr-Ser-Leu-Ile-His-Ser-Leu-Ile-Glu-Glu-Ser-Gln-Asn-Gln-Gln-Glu-Lys-Asn-Glu-Gln-Glu-Leu-Leu-Glu-Leu-Asp-Lys-Trp-Ala-Ser-Leu-Trp-Asn-Trp-Asn-Trp-Phe-NH2 159519-65-0
Arg-Lys-Asp-Val-Tyr-OH 69558-55-0
Terlipressin 14636-12-5
H-Ser-Val-Ser-Glu-Ile-Gln-Leu-Met-His-Asn-Leu-Gly-Lys-His-Leu-Asn-Ser-Met-Glu-Arg-Val-Glu-Trp-Leu-Arg-Lys-Lys-Leu-Gln-Asp-Val-His-Asn-Phe-OH 52232-67-4
Somatostatin-14 (coupled to BSA) 38916-34-6
GRF (1-29) amide (human) 86168-78-7
Pyr-His-Trp-Ser-Tyr-D-Ser(tBu)-Leu-Arg-Pro-Azagly-Gly-NH2 65807-02-5
His-Gly-Gly-Gly-Thr-Phe-Thr-Ser-Asp-Leu-Ser-Lys-Gln-Met-Glu-Glu-Glu-Ala-Val-Arg-Leu-Phe-Ile-Glu-Trp-Leu-Lys-Asn-Gly-Gly-Pro-Ser-Ser-Gly-Ala-Pro-Pro-Pro-Ser-NH2 141732-76-5
Mpr-Harg-Gly-Asp-Trp-Pro-Cys-NH2,( Disulfide Bridg on Mpr and Cys) 148031-34-9
Calcitonin (salmon I) 47931-85-1
(Des-Gly10,D-Ser(tBu)6,Pro-NHEt9)-LHRH 57982-77-1
[Mpr-D-Tyr(OEt)-Ile-Thr-Asn-Cys]-Pro-Orn-Gly-NH2 90779-69-4
pGlu-His-Trp-Ser-Tyr-D-Ala-Leu-Arg-Pro-NHEt 79561-22-1
Ac-D-Nal-D-Cpa-D-Pal-Ser-Tyr-D-Cit-Leu-Arg-Pro-D-Ala-NH2 120287-85-6
ω-Conotoxin MVIIA 107452-89-1
(D-Trp6)-LHRH 57773-63-4
Thymosin β4 (human, bovine, horse, rat) 77591-33-4
Ac-Ser-Asp-Ala-Ala-Val-Asp-Thr-Ser-Ser-Glu-Ile-Thr-Thr-Lys-Asp-Leu-Lys-Glu-Lys-Lys-Glu-Val-Val-Glu-Glu-Ala-Glu-Asn-OH 62304-98-7
H-His-Ser-Asp-Gly-Thr-Phe-Thr-Ser-Glu-Leu-Ser-Arg-Leu-Arg-Asp-Ser-Ala-Arg-Leu-Gln-Arg-Leu-Leu-Gln-Gly-Leu-Val-NH2 17034-35-4
Ac-Nle-cyclo(-Asp-His-D-Phe-Arg-Trp-Lys)-OH 189691-06-3
Lys-Cys-Asn-Thr-Ala-Thr-Cys-Ala-Thr-Gln-Arg-Leu-Ala-Asn-Phe-Leu-Val-His-Ser-Ser-Asn-Asn-Phe-Gly-Pro-Ile-Leu-Pro-Pro-Thr-Asn-Val-Gly-Ser-Asn-Thr-Tyr-NH2 196078-30-5
H-Cys-Tyr-Phe-Gln-Asn-Cys-Pro-Orn-Gly-NH2 3397-23-7
Oxytocin 50-56-6
D-Phe-Cys-Phe-D-Trp-Lys-Thr-Cys-Thr-ol 83150-76-9
Ser-Pro-Lys-Met-Val-Gln-Gly-Ser-Gly-Cys-Phe-Gly-Arg-Lys-Met-Asp-Arg-Ile-Ser-Ser-Ser-Ser-Gly-Leu-Gly-Cys-Lys-Val-Leu-Arg-Arg-His-OH 114471-18-0
Acetyl-(Nle4,Asp5,D-Phe7,Lys10)-cyclo-α-MSH (4-10) amide 121062-08-6
Cys-Tyr-Phe-Gln-Asn-Cys-Pro-Lys-Gly-NH2 50-57-7
pGlu-His-Trp-Ser-Tyr-D-Leu-Leu-Arg-Pro-NHEt 53714-56-0
His-2-Me-D-Trp-Ala-Trp-D-Phe-Lys-Lys-NH2 140703-51-1
(D-Trp7,Ala8,D-Phe10)-α-MSH (6-11) amide 87616-84-0
D-Ala-D-β-Nal-Ala-Trp-D-Phe-Lys-NH2 158861-67-7
Glucagon (1-29) (human, rat, porcine) 16941-32-5
CH3CO-Tyr-Thr-Ser-Leu-Ile-His-Ser-Leu-Ile-Glu-Glu-Ser-Gln-Asn-Gln-Gln-Glu-Lys-Asn-Glu-Gln-Glu-Leu-Leu-Glu-Leu-Asp-Lys-Trp-Ala-Ser-Leu-Trp-Asn-Trp-Phe-NH2 60731-46-6
Mpr-Tyr-Phe-Gln-Asn-Cys-Pro-D-Arg-Gly-NH2(S-S:1-6) 16789-98-3
D-Phe-Pro-Arg-Pro-Gly-Gly-Gly-Gly-Asn-Gly-Asp-Phe -Glu-Glu-Ile-Pro-Glu -Glu-Tyr-Leu-OH 128270-60-0
Palmitoyl-gly-gln-pro-arg-OH
H-Asn-Arg-Val-Tyr-Val-His-Pro-Phe-OH 20071-00-5
Pal-Val-Gly-Val-Ala-Pro-Gly-OH
Ac-Glu-Glu-Met-Glu-Arg-Arg-NH2 616204-22-9
Pal-Lys-Thr-Thr-Lys-Ser-OH 214047-00-4
H-Gly-His-Lys-OH:Cu 49557-75-7
Copoly-S-methyl-L-cysteine and L-methionine
Multichain poly-L-lysine poly-L-alanine
Copoly-γ-Benzgl-L-glutamate and L-Trpptophan
Poly-L-prolylglycyl-L-phenylalanine
Copoly-L-alanine and L-lysine
Poly-L-prolylglycyl-L-leucine
Poly-L-lysyl-L-alanyl-L-glutamic acid
Poly-L-leucyl-L-ornithyl-L-leucine
Poly-L-lysyl-L-alanyl-L-alanine
Poly-L-valyl-DL-lysine
Poly-L-alanyl-L-leucylglycine
Copoly-L-lysine and L-glutamine
Poly-L-glutamylglycine
1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101

Copyright 2007©  ChemicalBook. All rights reserved.