ChemicalBook
Chinese english Germany Japanese Korea

GRF (1-44) (HUMAN) Produkt Beschreibung

GRF (1-44) (HUMAN) Struktur
83930-13-6
CAS-Nr.
83930-13-6
Englisch Name:
GRF (1-44) (HUMAN)
Synonyma:
HPGRF;SOMATORELIN;GRF (HUMAN);HPGRF, HUMAN;GHRH (HUMAN);SOMATOLIBERIN;GRF Acetate;GHRF (1-44) HUMAN;GRF(human) Acetate;SERMORELIN (HUMAN)
CBNumber:
CB3311932
Summenformel:
C215H358N72O66S
Molgewicht:
5039.65082
MOL-Datei:
83930-13-6.mol

GRF (1-44) (HUMAN) Eigenschaften

storage temp. 
−20°C
Aggregatzustand
powder

Sicherheit

WGK Germany  3

GRF (1-44) (HUMAN) Chemische Eigenschaften,Einsatz,Produktion Methoden

GRF (1-44) (HUMAN) Upstream-Materialien And Downstream Produkte

Upstream-Materialien

Downstream Produkte


GRF (1-44) (HUMAN) Anbieter Lieferant Produzent Hersteller Vertrieb Händler.

Global( 64)Lieferanten
Firmenname Telefon Fax E-Mail Land Produktkatalog Edge Rate
Alpha Biopharmaceuticals Co., Ltd
0086-411-39042497
0086-411-39042693 sales@alphabiopharm.com China 921 58
career henan chemical co
+86-371-86658258
sales@coreychem.com CHINA 30001 58
Hubei xin bonus chemical co. LTD
86-13657291602
027-59338440 sales@guangaobio.com CHINA 23049 58
Chongqing Chemdad Co., Ltd
+86-13650506873
sales@chemdad.com CHINA 35440 58
Cellmano Biotech Limited
+86-551-65326643
+86-551-65326641 info@cellmano.com CHINA 1044 58
J & K SCIENTIFIC LTD. 400-666-7788 +86-10-82848833
86-10-82849933 jkinfo@jkchemical.com;market6@jkchemical.com China 96815 76
Arden pharmaceutical &chemical Co., Ltd +86-(0)533-3595900 13793319233
+86-(0)533-3595900 info@chems.com.cn China 669 61
Alabiochem Tech.Co., Ltd. 0086-512-58900862; 400-0707-518; 0086-512-56727736
0086-512-56765862 sales@alabiochem.com China 995 59
Shanghai Hanhong Scientific Co.,Ltd. 021-54306202,021-54308259
+86-21-64545202 info@hanhonggroup.com China 43260 64
Chemsky(shanghai)International Co.,Ltd. 021-50135380
shchemsky@sina.com China 32362 50

83930-13-6()Verwandte Suche:


  • SERMORELIN (HUMAN)
  • SOMATOCRININ (HUMAN)
  • SOMATOLIBERIN (HUMAN)
  • SOMATORELIN
  • YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL-NH2
  • TYR-ALA-ASP-ALA-ILE-PHE-THR-ASN-SER-TYR-ARG-LYS-VAL-LEU-GLY-GLN-LEU-SER-ALA-ARG-LYS-LEU-LEU-GLN-ASP-ILE-MET-SER-ARG-GLN-GLN-GLY-GLU-SER-ASN-GLN-GLU-ARG-GLY-ALA-ARG-ALA-ARG-LEU-NH2
  • GRF(human) Acetate
  • H-Tyr-Ala-Asp-Ala-Lle-Phe-Thr-Asn-Ser-Tyr-Arg-Lys-Val-Leu-Gly-Gln-Leu-Ser-Ala-Arg-lys-Leu-Leu-Gln-Asp-Lle-Met-Ser-Arg-Gln-Gln-Gly-Glu-Ser-Asn-Gln-Glu-Arg-Gly-Ala-Arg-Ala-Arg-Leu-NH2
  • SOMATOLIBERIN
  • M.W. 5039.72 C215H358N72O66S
  • Human growth hormone-releasing hormone (1-44) amide
  • Somatorelin Acetate
  • Growth-hormone-releasing hormone
  • GRF (huMan) SoMatoliberin (huMan), SoMatocrinin (huMan), SoMatorelin (huMan), Growth HorMone-Releasing Factor (huMan), Growth HorMone-Releasing HorMone (huMan), GHRH (huMan), SoMatorelin
  • SoMatoliberin (huMan), SoMatocrinin (huMan), SoMatorelin (huMan), Growth HorMone-Releasing Factor (huMan), Growth HorMone-Releasing HorMone (huMan), GHRH (huMan), SoMatorelin
  • Growth HorMone Releasing Factor huManGrowth HorMone Releasing Fa
  • H-Tyr-Ala-Asp-Ala-Ile-Phe-Thr-Asn-Ser-Tyr-Arg-Lys-Val-Leu-Gly-Gln-Leu-Ser-Ala-Arg-Lys-Leu-Leu-Gln-Asp-Ile-Met-Ser-Arg-Gln-Gln-Gly-Glu-Ser-Asn-Gln-Glu-Arg-Gly-Ala-Arg-Ala-Arg-Leu-NH2 acetate salt
  • YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL
  • Human growth hormone-releasing factor
  • GRF (human)|GHRF (1-44), human
  • GRF Acetate
  • H-TYR-ALA-ASP-ALA-ILE-PHE-THR-ASN-SER-TYR-ARG-LYS-VAL-LEU-GLY-GLN-LEU-SER-ALA-ARG-LYS-LEU-LEU-GLN-ASP-ILE-MET-SER-ARG-GLN-GLN-GLY-GLU-SER-ASN-GLN-GLU-ARG-GLY-ALA-ARG-ALA-ARG-LEU-NH2
  • H-TYR-ALA-ASP-ALA-ILE-PHE-THR-ASN-SER-TYR-ARG-LYS-VAL-LEU-GLY-GLN-LEU-SER-ALA-ARG-LYS-LEU-LEU-GLN-ASP-ILE-MET-SER-ARG-GLN-GLN-GLY-GLU-SER-ASN-GLN-GLU-ARG-GLY-ALA-ARG-ALA-ARG-LEU-OH
  • HPGRF
  • HPGRF, HUMAN
  • GROWTH HORMONE-RELEASING HORMONE (HUMAN)
  • GROWTH HORMONE RELEASING FACTOR (1-44), HUMAN
  • GROWTH HORMONE RELEASING FACTOR, HUMAN
  • GROWTH HORMONE RELEASING FACTOR (1-44), AMIDE, HUMAN
  • GRF (1-44), AMIDE, HUMAN
  • GRF (1-44) (HUMAN)
  • GRF (HUMAN)
  • GHFR (1-44), HUMAN
  • GHRH (1-44), HUMAN
  • GHRH (HUMAN)
  • GHRF (1-44) HUMAN
  • 83930-13-6
  • C215H358N72O66S
  • Amino Acids and Peptides
  • BioChemical
  • GH-RH
  • Releasing Factors
  • Peptides
  • Biochemicals and Reagents
  • Peptide
  • VIP and PACAP receptor
  • peptides pharm
Copyright 2019 © ChemicalBook. All rights reserved