ChemicalBook Chinese Germany Japanese Korean

Creative Peptides Company Information

Company Name:    Creative Peptides
Tel:    1-631-619-7922
Email:    info@creative-peptides.com
Nationality:    United States
WebSite:    www.creative-peptides.com
Product List:    6084
50 51 52 53 54 55 56 57 58 59 60 61

Product List
Secretin, porcine 17034-34-3
Substance P 1-7 68060-49-1
Secretin (porcine) Hydrochloride 17034-35-4
Somatostatin-28 1-14 79243-10-0
Sarcoma antigen 1 (715-723)
RGD 99896-85-2
Secretin (33-59), rat 121028-49-7
RGD Trifluoroacetate
Substance P (1-7)(TFA)
Renin Substrate 1 trifluoroacetate salt 791068-69-4
RGD peptide (GRGDNP) TFA
Small Cardioactive Peptide B SCPB 84746-43-0
Secretin (human) Hydrochloride 108153-74-8
Somatostatin-28 1-12 81286-16-0
Scrambled10Panx 1315378-72-3
Relaxin H2 (human) trifluoroacetate salt 99489-94-8
SAMS 125911-68-4
Serine protease hepsin (229-237)
Succinyl-(Glu9,Ala11ยท15)-Endothelin-1 (8-21) 142569-99-1
Scyliorhinin I 103425-21-4
Sauvagine trifluoroacetate salt 74434-59-6
SEB Domain 144-153 210229-94-0
SNAP-25 187-203 216568-37-5
Sakamototide substrate peptide TFA
Similar to calgizzarin; similar to PID:g3115349 (40-49)
Smcy HY Peptide 738-746 207113-06-2
Sulforhodamine 101; Sulforhodamine 640 60311-02-6
Rho guanine nucleotide exchange factor 17 (425-438)
RER1 protein (80-91)
Small subunit processome component 20 homolog (626-634)
Survivin (18-27)
Staphylococcus Aureus Protein A (SpA)-DerivedPeptide 144979-26-0
Spadin 1270083-24-3
SNX 482 203460-30-4
Rhodamine 101;Rhodamine 640 64339-18-0
Romidepsin 128517-07-7
Steroidogenesis-Activator Polypeptide 108563-23-1
Sodium-coupled monocarboxylate transporter 2 (343-356)
Serine/threonine-protein kinase B-raf (586-614)
Secernin-1 (196-204)
Romurtide 78113-36-7
Somatostatin Acetate 51110-01-1
Rhodopsin Epitope Tag
st-Ht31 188425-80-1
Super-TDU 1-31
Substance P 1-9 57468-17-4
Substance P Acetate 33507-63-0
SSA protein SS-56 (55-64)
Rho-related GTP-binding protein RhoC (176-185)
Serine protease hepsin (191-199)
Selepressin 876296-47-8
Sphistin Synthetic Peptide(12-38,Fitc in N-Terminal-Fluorescently Labeled Peptide)
RGD-4C 332179-76-7
Scyliorhinin II 112748-19-3
sn-Glycero-3-phosphocholine 28319-77-9
Survivin (96-104)
Serine/threonine-protein kinase mTOR (89-98)
Survivin (80-88)
Shepherdin 79-87 861224-28-4
Splenopentin Acetate 105184-37-0
Rusalatide acetate 875455-82-6
SLLK, Control Peptide for TSP1 Inhibitor(TFA)
Sinapultide 138531-07-4
Suc-Leu-Leu-Val-Tyr-AMC 94367-21-2
Ribosomal protein S26 (47-61)
Small nuclear ribonucleoprotein Sm D1 (11-19)
Sperm surface protein Sp17 (103-111)
rGHRH(1-29)NH2
RGD peptide GRGDNP 114681-65-1
Substance P, Free Acid 71977-09-8
st-Ht31 P 252869-81-1
S Tag Peptide 7429-70-1
Solanezumab 955085-14-0
Structure-specific endonuclease subunit SLX4 (603-615)
Retinal dehydrogenase 1 (88-96)
Ribosome-binding protein 1 (879-887)
Resveratrol 501-36-0
Secretoneurin, rat 149146-12-3
Sincalide Ammonium Salt 25126-32-3
Somatostatin-25 76461-17-1
sgp91 ds-tat Peptide 2, scrambled
RF9 trifluoroacetate salt 876310-60-0
Speract 76901-59-2
Rotigaptide 355151-12-1
Serine protease hepsin (268-276)
SDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS
SIYRY 178561-37-0
Suc-Arg-Pro-Phe-His-Leu-Leu-Val-Tyr-AMC trifluoroacetate salt 76524-84-0
Substance P 7-11 51165-05-0
Succinyl-(Pro58,D-Glu65)-Hirudin (56-65) (sulfated) 131791-98-5
Suc-Pro-OH 63250-32-8
Semaglutide 910463-68-2
Secretin, canine 110786-77-1
RPL8 protein (31-41)
Surface IgG (sA20-Ig) of A20 (106-114)
SPACE peptide 1621717-95-0
RNAIII-inhibiting peptide(TFA)
SLLK, Control Peptide for TSP1 Inhibitor 464924-27-4
Suc-Leu-Tyr-AMC 94367-20-1
Sarafotoxin C trifluoroacetate salt 121695-87-2
50 51 52 53 54 55 56 57 58 59 60 61

Copyright 2007©  ChemicalBook. All rights reserved.