ChemicalBook
Chinese english Germany Japanese Korea

Seractide Produkt Beschreibung

Seractide Struktur
12279-41-3
CAS-Nr.
12279-41-3
Englisch Name:
Seractide
Synonyma:
ACTH;ACTH 1-39;Seractide;CORTICOTROPHIN;CORTICOTROPIN A;Seractide acetate;ACTH (1-39), HUMAN;CORTICOTROPIN (HUMAN);M.W. 4541.07 C207H308N56O58S;ACTH(1-39) CORTICOTROPIN, HUMAN
CBNumber:
CB3318698
Summenformel:
C207H308N56O58S1
Molgewicht:
4541.07
MOL-Datei:
12279-41-3.mol

Seractide Eigenschaften

storage temp. 
−20°C
Löslichkeit
H2O: 1 mg/mL, clear, colorless
Sicherheit
  • Risiko- und Sicherheitserklärung
  • Gefahreninformationscode (GHS)
Kennzeichnung gefährlicher Xn
R-Sätze: 20/21/22-40
S-Sätze: 22-36
WGK Germany  3
RTECS-Nr. GM7900000
8-10
Bildanzeige (GHS)
Alarmwort Warnung
Gefahrenhinweise
Code Gefahrenhinweise Gefahrenklasse Abteilung Alarmwort Symbol P-Code
H302 Gesundheitsschädlich bei Verschlucken. Akute Toxizität oral Kategorie 4 Warnung P264, P270, P301+P312, P330, P501
H312 Gesundheitsschädlich bei Hautkontakt. Akute Toxizität dermal Kategorie 4 Warnung P280,P302+P352, P312, P322, P363,P501
H332 Gesundheitsschädlich bei Einatmen. Akute Toxizität inhalativ Kategorie 4 Warnung P261, P271, P304+P340, P312
H351 Kann vermutlich Krebs verursachen. Karzinogenität Kategorie 2 Warnung P201, P202, P281, P308+P313, P405,P501
Sicherheit
P201 Vor Gebrauch besondere Anweisungen einholen.
P261 Einatmen von Staub vermeiden.
P280 Schutzhandschuhe/Schutzkleidung/Augenschutz tragen.
P304+P340 BEI EINATMEN: Die Person an die frische Luft bringen und für ungehinderte Atmung sorgen.
P405 Unter Verschluss aufbewahren.

Seractide Chemische Eigenschaften,Einsatz,Produktion Methoden

R-Sätze Betriebsanweisung:

R20/21/22:Gesundheitsschädlich beim Einatmen,Verschlucken und Berührung mit der Haut.
R40:Verdacht auf krebserzeugende Wirkung.

S-Sätze Betriebsanweisung:

S22:Staub nicht einatmen.
S36:DE: Bei der Arbeit geeignete Schutzkleidung tragen.

Verwenden

Hormone (adrenocorticotropic).

Trademarks

Acthar Gel-Synthetic (Armour).

Seractide Upstream-Materialien And Downstream Produkte

Upstream-Materialien

Downstream Produkte


Seractide Anbieter Lieferant Produzent Hersteller Vertrieb Händler.

Global( 58)Lieferanten
Firmenname Telefon Fax E-Mail Land Produktkatalog Edge Rate
Alpha Biopharmaceuticals Co., Ltd
0086-411-39042497
0086-411-39042693 sales@alphabiopharm.com China 921 58
ATK CHEMICAL COMPANY LIMITED
+86 21 5161 9050/ 5187 7795
+86 21 5161 9052/ 5187 7796 ivan@atkchemical.com CHINA 24191 60
Shanghai Longyu Biotechnology Co., Ltd.
+8615821988213
info@longyupharma.com CHINA 690 58
Cellmano Biotech Limited
+86-551-65326643
+86-551-65326641 info@cellmano.com CHINA 1044 58
J & K SCIENTIFIC LTD. 400-666-7788 +86-10-82848833
86-10-82849933 jkinfo@jkchemical.com;market6@jkchemical.com China 96815 76
3B Pharmachem (Wuhan) International Co.,Ltd. 86-21-50328103 * 801、802、803、804 Mobile:18930552037
86-21-50328109 3bsc@sina.com China 15881 69
Alabiochem Tech.Co., Ltd. 0086-512-58900862; 400-0707-518; 0086-512-56727736
0086-512-56765862 sales@alabiochem.com China 995 59
GL Biochem (Shanghai) Ltd 86-21-61263452 (tel), 86-13641803416(mobile)
86-21-61263399 ymbetter@glbiochem.com China 9721 64
Shanghai Hanhong Scientific Co.,Ltd. 021-54306202,021-54308259
+86-21-64545202 info@hanhonggroup.com China 43260 64
Chemsky(shanghai)International Co.,Ltd. 021-50135380
shchemsky@sina.com China 32362 50

12279-41-3()Verwandte Suche:


  • ACTH (1-39) (human) trifluoroacetate salt H-Ser-Tyr-Ser-Met-Glu-His-Phe-Arg-Trp-Gly-Lys-Pro-Val-Gly-Lys-Lys-Arg-Arg-Pro-Val-Lys-Val-Tyr-Pro-Asn-Gly-Ala-Glu-Asp-Glu-Ser-Ala-Glu-Ala-Phe-Pro-Leu-Glu-Phe-OH trifluoroacetate salt
  • ACTH (1-39), HUMAN
  • ACTH 1-39
  • ACTH
  • ADRENOCORTICOTROPIC HORMONE HUMAN
  • ADRENOCORTICOTROPIC HORMONE (1-39) (HUMAN)
  • SER-TYR-SER-MET-GLU-HIS-PHE-ARG-TRP-GLY-LYS-PRO-VAL-GLY-LYS-LYS-ARG-ARG-PRO-VAL-LYS-VAL-TYR-PRO-ASN-GLY-ALA-GLU-ASP-GLU-SER-ALA-GLU-ALA-PHE-PRO-LEU-GLU-PHE
  • SER-TYR-SER-MET-GLU-HIS-PHE-ARG-TRP-GLY-LYS-PRO-VAL-GLY-LYS-LYS-ARG-ARG-PRO-VAL-LYS-VAL-TYR-PRO-ASN-GLY-ALA-GLU-ASP-GLU-SER-ALA-GLU-ALA-PHE-PRO-LEU-GLU-PHE HUMAN
  • SYSMEHFRWGKPVGKKRRPVKVYPNGAEDESAEAFPLEF
  • H-Ser-Tyr-Ser-Met-Glu-His-Phe-Arg-Trp-Gly-Lys-Lys-Arg-Arg-Pro-Val-Lys-Val-Tyr-Pro-Asn-Gly-Ala-Glu-Asp-Glu-Ser-Ala-Glu-Ala-Phe-Pro-Leu-Glu-Phe-OH
  • adrenocorticotropic hormone fragment 1-39
  • ACTH(1-39) CORTICOTROPIN, HUMAN
  • L-Seryl-L-tyrosyl-L-seryl-L-methionyl-L-alpha-glutamyl-L-histidyl-L-phenylalanyl-L-arginyl-L-tryptophylglycyl-L-lysyl-L-prolyl-L-valylglycyl-L-lysyl-L-lysyl-L-arginyl-L-arginyl-L-prolyl-L-valyl-L-lysyl-L-valyl-L-tyrosyl-L-prolyl-L-asparaginylglycyl-L-alanyl-L-alpha-glutamyl-L-alpha-aspartyl-L-alpha-glutamyl-L-seryl-L-alanyl-L-alpha-glutamyl-L-alanyl-L-phenylalanyl-L-prolyl-L-leucyl-L-alpha-glutamyl-L-phenylalanine
  • M.W. 4541.07 C207H308N56O58S
  • Seractide
  • REF DUPL: Ser-Tyr-Ser-Met-Glu-His-Phe-Arg-Trp-Gly-Lys-Pro-Val-Gly-Lys-Lys-Arg-Arg-Pro-Val-Lys-Val-Tyr-Pro-Asn-Gly-Ala-Glu-Asp-Glu-Ser-Ala-Glu-Ala-Phe-Pro-Leu-Glu-Phe
  • CORTICOTROPIN (HUMAN)
  • CORTICOTROPHIN
  • CORTICOTROPIN A
  • H-SER-TYR-SER-MET-GLU-HIS-PHE-ARG-TRP-GLY-LYS-PRO-VAL-GLY-LYS-LYS-ARG-ARG-PRO-VAL-LYS-VAL-TYR-PRO-ASN-GLY-ALA-GLU-ASP-GLU-SER-ALA-GLU-ALA-PHE-PRO-LEU-GLU-PHE-OH
  • ACTH (1-39) (huMan) Corticotropin
  • Adrenocorticotropic Hormone (ACTH) (1-39)
  • Seractide acetate
  • Adrenocorticotropic Hormone (ACTH) (1-39), human
  • 12279-41-3
  • C209H308N56O58S
  • Cell Signaling and Neuroscience
  • Cell Biology
  • Adrenocorticotrophic Hormone (ACTH)
  • BioChemical
  • Fluoride Sources
  • Deprotection
  • Cytokines, Growth Factors and Hormones
  • Protection and Derivatization
  • Pituitary Hormones
  • Hormones
  • Synthetic Reagents
  • Peptide
  • Melanocortin receptor
Copyright 2019 © ChemicalBook. All rights reserved