ChemicalBook >> CAS DataBase List >>CART (55-102) (RAT)

CART (55-102) (RAT)

CAS No.
209615-79-2
Chemical Name:
CART (55-102) (RAT)
Synonyms
CART (55-102);CART (RAT, 55-102);CART (55-102) (RAT);CART, MOUSE/RAT, (55-102);CARP, MOUSE/RAT, (55-102);CART(55-102)(rat) acetate;CART Fragment 55-102 rat;CART PEPTIDE (AA 55-102), RAT;CART Fragment 55-102 human;COCAINE- AND AMPHETAMINE-REGULATED TRANSCRIPT
CBNumber:
CB0218173
Molecular Formula:
C226H367N65O65S7
Molecular Weight:
5259.18368
MDL Number:
MFCD01865992
MOL File:
209615-79-2.mol
Last updated:2023-06-30 15:45:59

CART (55-102) (RAT) Properties

storage temp. -15°C
Water Solubility Soluble to 1 mg/ml in Water

CART (55-102) (RAT) price More Price(9)

Manufacturer Product number Product description CAS number Packaging Price Updated Buy
Tocris 3337 CART(55-102)(rat) 209615-79-2 100U $294 2021-12-16 Buy
Usbiological 152422 Cocaine And Amphetamine Regulated Transcript 209615-79-2 96Tests $824 2021-12-16 Buy
Usbiological 024249 Cocaine And Amphetamine Regulated Transcript 209615-79-2 96Tests $851 2021-12-16 Buy
Biosynth Carbosynth FC109275 CART (55-102) (rat) H-Ile-Pro-Ile-Tyr-Glu-Lys-Lys-Tyr-Gly-Gln-Val-Pro-Met-Cys-Asp-Ala-Gly-Glu-Gln-Cys-Ala-Val-Arg-Lys-Gly-Ala-Arg-Ile-Gly-Lys-Leu-Cys-Asp-Cys-Pro-Arg-Gly-Thr-Ser-Cys-Asn-Ser-Phe-Leu-Leu-Lys-Cys-Leu-OH (Disulfide bonds between Cys68 and Cys86/Cys74 and Cys94/Cys88 and Cys101) 209615-79-2 500ug $1185 2021-12-16 Buy
Biosynth Carbosynth FC109275 CART (55-102) (rat) H-Ile-Pro-Ile-Tyr-Glu-Lys-Lys-Tyr-Gly-Gln-Val-Pro-Met-Cys-Asp-Ala-Gly-Glu-Gln-Cys-Ala-Val-Arg-Lys-Gly-Ala-Arg-Ile-Gly-Lys-Leu-Cys-Asp-Cys-Pro-Arg-Gly-Thr-Ser-Cys-Asn-Ser-Phe-Leu-Leu-Lys-Cys-Leu-OH (Disulfide bonds between Cys68 and Cys86/Cys74 and Cys94/Cys88 and Cys101) 209615-79-2 25ug $112 2021-12-16 Buy
Product number Packaging Price Buy
3337 100U $294 Buy
152422 96Tests $824 Buy
024249 96Tests $851 Buy
FC109275 500ug $1185 Buy
FC109275 25ug $112 Buy

CART (55-102) (RAT) Chemical Properties,Uses,Production

Structure

CART peptides of different lengths have been found in various tissues. The rat central nervous system contains CART55–102 and CART62–102 fragments. In the periphery, longer products are generated in addition to CART55–102. Adrenal glands in the rat produce two peptides, CART1–89 and CART10–89. The most widely studied peptides are CART55–102 and CART62–102 . Both peptides contain a cysteine-knot motif, which is critical for the biological activity of the hormone. The human CART42–89 corresponds to the rodent CART55–102. Genome studies have revealed that fish have multiple CART genes. Two different goldfish CART55–102 (Goldfish I and II) genes present high homology with their mammalian counterparts in their C-terminal end region.
	CART (55-102) (RAT)

Gene, mRNA, and precursor

The human CART gene, CARTPT, located in the 5q13.2 region, consists of two introns and three exons. Due to alternative splicing, the rodent CART mRNA produces two spliced variants of proCART. Long and short forms encode a 102 aa sequence or an 89 aa sequence, respectively. Only the latter has been found in humans.

Synthesis and release

In hypothalamic explants, the neuropeptide Y (NPY) significantly increased the release of CART (55–102) immunoreactivity. In vivo experiments showed that leptin administration induces Fos expression in hypothalamic CART neurons. NPY and CART are coexpressed in the same neurons in the dorsomedial hypothalamus in chronic obesity. These neurons are activated by peripheral leptin treatment in diet-induced obesity. Thus, CART peptides are anorexigenic and closely associated with leptin and NPY, two important food intake regulators. CART is also released in response to repeated dopamine release in the nucleus accumbens.

Receptors

Although CART-responsive cell lines or neurons were reported, the receptor for CART has not been clarified yet. It is speculated that CART55–102 and CART62–102 do not share the same receptor, as they show different physiological activities in vivo. In 2020, CART55-102 was suggested to be a ligand of an orphan GPCR, GPR160, from biological assays. Further pharmacology would be required on GPR160 and CART for confirmation. The signal transduction pathway is predicted to be mainly coupled to the Gi/o protein and to stimulate ERK1/2 activation or inhibit calcium signaling.

Biological functions

In the goldfish, the central administration of human CART has been shown to decrease food intake. In mammals, CART modulates various physiological processes such as feeding, energy expenditure, stress control, and endocrine secretion.

Clinical implications

In an obese 10-year-old boy, where the onset of obesity was at the age of 2, a G-to-C transversion at nucleotide 729 of the CART gene was identified, resulting in missense mutation, a leucine to phenylalanine substitution at codon 34 (L34F). This mutation affects posttranslational processing and causes bioactive CART deficiency in the serum. The L34F mutation segregated with severe obesity over three generations in this family, and was not identified in the control population. The affected subjects demonstrated reduced resting energy expenditures. Further, sequence variability in the CART gene has been identified as being related to obesity in several hundred French subjects.

General Description

CART, so named because of upregulation by cocaine and amphetamine, is thought to be involved in the regulation of feeding and stress. However, its cognate receptor has not yet been identified. In the 1980s, a fragment of the CART peptide was identified in an extract of ovine hypothalamus. Fifteen years later, the level of CART mRNA was found to increase in the rat striatum after acute administration of cocaine and amphetamine. Subsequently, in 1999, CART peptides were extracted and sequenced from the rat, and it was found that two different forms (CART55–102 and CART62–102) were present.

storage

Store at -20°C

CART (55-102) (RAT) Preparation Products And Raw materials

Raw materials

Preparation Products

CART (55-102) (RAT) Suppliers

Global( 60)Suppliers
Supplier Tel Email Country ProdList Advantage
career henan chemical co
+86-0371-86658258 15093356674; factory@coreychem.com China 29826 58
Chengdu Youngshe Chemical Co., Ltd.
+8618108235634 Cecilia@youngshechem.com China 2345 58
Nanjing TGpeptide
+86-13347807150 +86-13347807150 support@tgpeptide.com China 3279 58
Zhejiang Hangyu API Co., Ltd
+8617531972939 anna@api-made.com China 2944 58
Aladdin Scientific
+1-+1(833)-552-7181 sales@aladdinsci.com United States 52927 58
3B Pharmachem (Wuhan) International Co.,Ltd. 821-50328103-801 18930552037 3bsc@sina.com China 15848 69
GL Biochem (Shanghai) Ltd 21-61263452 13641803416 ymbetter@glbiochem.com China 9981 64
Shanghai Hanhong Scientific Co.,Ltd. 021-54306202 13764082696 info@hanhongsci.com China 42982 64
Chemsky (shanghai) International Co.,Ltd 021-50135380 shchemsky@sina.com China 15421 60
Cellmano Biotech Limited 0551-65326643 18156095617 info@cellmano.com China 1011 55

View Lastest Price from CART (55-102) (RAT) manufacturers

Image Update time Product Price Min. Order Purity Supply Ability Manufacturer
	CART (55-102) (RAT) pictures 2020-02-14 CART (55-102) (RAT)
209615-79-2
US $7.00 / KG 1KG 99% 100KG Career Henan Chemical Co
CART, MOUSE/RAT, (55-102) CART (55-102) CART PEPTIDE (AA 55-102), RAT CART (RAT, 55-102) COCAINE- AND AMPHETAMINE-REGULATED TRANSCRIPT COCAINE-AND AMPHETAMINE-REGULATED TRANSCRIPT (55-102) (RAT) COCAINE- AND AMPHETAMINE-REGULATED TRANSCRIPT (RAT, 55-102) COCAINE- AND AMPHETAMINE RELATED TRANSCRIPT, MOUSE/RAT, (55-102) IPIYEKKYGQVPMCDAGEQCAVRKGARIGKLCDCPRGTSCNSFLLKCL (DISULFIDE BRIDGE: 74-94,68-86 AND 88-101) ILE-PRO-ILE-TYR-GLU-LYS-LYS-TYR-GLY-GLN-VAL-PRO-MET-CYS-ASP-ALA-GLY-GLU-GLN-CYS-ALA-VAL-ARG-LYS-GLY-ALA-ARG-ILE-GLY-LYS-LEU-CYS-ASP-CYS-PRO-ARG-GLY-THR-SER-CYS-ASN-SER-PHE-LEU-LEU-LYS-CYS-LEU H-ILE-PRO-ILE-TYR-GLU-LYS-LYS-TYR-GLY-GLN-VAL-PRO-MET-CYS-ASP-ALA-GLY-GLU-GLN-CYA-ALA-VAL-ARG-LYS-GLY-ALA-ARG-ILE-GLY-LYS-LEU-CYS-ASP-CYS-PRO-ARG-GLY-THR-SER-CYS-ASN-SER-PHELEU-LEU-LYS-CYS-LEU-OH H-ILE-PRO-ILE-TYR-GLU-LYS-LYS-TYR-GLY-GLN-VAL-PRO-MET-CYS-ASP-ALA-GLY-GLU-GLN-CYS-ALA-VAL-ARG-LYS-GLY-ALA-ARG-ILE-GLY-LYS-LEU-CYS-ASP-CYS-PRO-ARG-GLY-THR-SER-CYS-ASN-SER-PHE-LEU-LEU-LYS-CYS-LEU-OH H-ILE-PRO-ILE-TYR-GLU-LYS-LYS-TYR-GLY-GLN-VAL-PRO-MET-CYS-ASP-ALA-GLY-GLU-GLN-CYS-ALA-VAL-ARG-LYS-GLY-ALA-ARG-ILE-GLY-LYS-LEU-CYS-ASP-CYS-PRO-ARG-GLY-THR-SER-CYS-ASN-SER-PHE-LEU-LEU-LYS-CYS-LEU-OH (DISULFIDE BRIDGE: 74-94, 68-86, AND 88-101) ILE-PRO-ILE-TYR-GLU-LYS-LYS-TYR-GLY-GLN-VAL-PRO-MET-CYS-ASP-ALA-GLY-GLU-GLN-CYS-ALA-VAL-ARG-LYS-GLY-ALA-ARG-ILE-GLY-LYS-LEU-CYS-ASP-CYS-PRO-ARG-GLY-THR-SER-CYS-ASN-SER-PHE-LEU-LEU-LYS-CYS-LEU: IPIYEKKYGQVPMCDAGEQCAVRKGARIGKLCDCPRGTSCNSFLLKCDISULFIDE BRIDG CART Fragment 55-102 human CART Fragment 55-102 rat L-Isoleucyl-L-prolyl-L-isoleucyl-L-tyrosyl-L-alpha-glutamyl-L-lysyl-L-lysyl-L-tyrosylglycyl-L-glutaminyl-L-valyl-L-prolyl-L-methionyl-L-cysteinyl-L-alpha-aspartyl-L-alanylglycyl-L-alpha-glutamyl-L-glutaminyl-L-cysteinyl-L-alanyl-L-valyl-L-arginyl-L-lysylglycyl-L-alanyl-L-arginyl-L-isoleucylglycyl-L-lysyl-L-leucyl-L-cysteinyl-L-alpha-aspartyl-L-cysteinyl-L-prolyl-L-arginylglycyl-L-threonyl-L-seryl-L-cysteinyl-L-asparaginyl-L-seryl-L-phenylalanyl-L-leucyl-L-leucyl-L-lysyl-L-cysteinyl-L-leucine cyclic (14-32),(20-40),(34-47)-tris(disulfide) CARP, MOUSE/RAT, (55-102) CART (55-102) (RAT) CART (55-102) (rat) H-Ile-Pro-Ile-Tyr-Glu-Lys-Lys-Tyr-Gly-Gln-Val-Pro-Met-Cys-Asp-Ala-Gly-Glu-Gln-Cys-Ala-Val-Arg-Lys-Gly-Ala-Arg-Ile-Gly-Lys-Leu-Cys-Asp-Cys-Pro-Arg-Gly-Thr-Ser-Cys-Asn-Ser-Phe-Leu-Leu-Lys-Cys-Leu-OH (Disulfide bonds between Cys68 and Cys86/Cys74 and Cys94/Cys88 and Cys101) L-Leucine,L-isoleucyl-L-prolyl-L-isoleucyl-L-tyrosyl-L-α-glutamyl-L-lysyl-L-lysyl-L-tyrosylglycyl-L-glutaminyl-L-valyl-L-prolyl-L-methionyl-L-cysteinyl-L-α-aspartyl-L-alanylglycyl-L-α-glutamyl-L-glutaminyl-L-cysteinyl-L-alanyl-L-valyl-L-arginyl-L-lysylglycyl-L-alanyl-L-arginyl-L-isoleucylglycyl-L-lysyl-L-leucyl-L-cysteinyl-L-α-aspartyl-L-cysteinyl-L-prolyl-L-arginylglycyl-L-threonyl-L-seryl-L-cysteinyl-L-asparaginyl-L-seryl-L-phenylalanyl-L-leucyl-L-leucyl-L-lysyl-L-cysteinyl-,cyclic(14→32),(20→40),(34→47)-tris(disulfide) CART(55-102)(rat) acetate 209615-79-2 C226H367N65O65S7 C225H365N65O65S7 peptide